Xchieve Platform
Welcome back
Sign in to continue your learning journey.
Xchieve Platform
Welcome back
Sign in to continue your learning journey.
Genetic Engineering & Biotechnology – Xchieve
CRISPR.designGuide(target="PCSK9", tool="Benchling", PAM="NGG", specificity=0.97); cas9.validate(offTargets=3, onTarget_efficiency=0.91); HDR.insert(donor_template, cut_site); Bioinformatics.pull("AAPL US Equity", fields=["PX_LAST","PE_RATIO","EV_TO_EBITDA"]); portfolio.rebalance(weights, target_vol=0.15); sharpe = (ret - rf) / std BLAST.search(query="ATGCGATCGATCG...", db="nr", e_value=0.001); alignment(identity=98.7%, gaps=0, score=1420); species=Homo_sapiens; protein.alphafold2(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQNTAYSAEGK"); PyMOL.visualise(pdb_id="7MHY"); binding_affinity = -8.4), Biopython.SeqIO.read("plasmid.gb","genbank"); restriction.digest(enzyme="EcoRI"); ligation.setup(vector=pUC19, insert=GOI, ratio="3:1", T4_ligase=True); WesternBlot.run(protein="p53", antibody="anti-p53_DO1", detection="HRP-ECL"); band_kDa=53; loading_ctrl="beta-actin"; exposure_time=30s; CellCulture.seed(line="HEK293T", density=2e5, media="DMEM+10%FBS"); transfection.lipofectamine(plasmid=2ug, reagent=6ul); incubate(37C, 5%CO2, 48h);
Govt. Recognised 🧬 Industry-Integrated LIVE
🧬 Genetic Engineering & Biotechnology Bootcamp

Genetic Engineering & Biotechnology

From CRISPR & PCR to Genomics & Bioinformatics — Master Recombinant DNA, Gene Editing & Molecular Biology and Land Roles at Top Biotech & Research Institutions

⭐
4.9 / 5 Rating
By 3,600+ learners
⚡
Live Bootcamp
Included in course
🗓️
16 Weeks Online
Flexible schedule
✓
100% Placement
Career guaranteed
DM
Lead Instructor Dr. Divya Menon
CRISPR Gene EditingGenomics & NGSProtein EngineeringBioinformaticsCell Biology
🎯 Beginner to Job-Ready · Basic biology or life sciences background helpful, not required
Certified By
🏅 Skill India 🏛️ NSDC ⚖️ MCA Govt. ✅ ISO Certified
Our Alumni Hired At
Biocon Dr. Reddy's Laboratories Cipla Piramal Pharma Serum Institute Strand Life Sciences Reliance Life Sciences Syngene International CSIR-IGIB IISc Bangalore
🧬
Your career in biotech & genetic engineering starts here.
Join thousands who already made the leap —
your dream biotech role is one course away
Job-Ready Mentor-Led Certified

Course Fee

₹12,999 Today only

₹33,000   Save ₹20,001/-

★ 4.9/5 • 3,600+ learners
  • 🕐 16 Weeks Online Programme
  • 💼 100% Placement Assistance
  • 📊 Live CRISPR & PCR Lab Simulations
Enroll Now → Enquire Now View Course Brochure Connect with our team
🗓 Updated Jun '25  ·  T&C apply
🎓Placement Assistance ✦ 📊Live CRISPR Gene Editing Labs ✦ 🏆Govt. Certified ✦ ⚡Live Bootcamp ✦ 🧬Bioinformatics Terminal Access ✦ 🧬Gene Sequencing & Genomics ✦ 🎯1-on-1 Mentorship ✦ 💼Career Guidance ✦ 📜Industry Certificate ✦ 🎓Placement Assistance ✦ 📊Live CRISPR Gene Editing Labs ✦ 🏆Govt. Certified ✦ ⚡Live Bootcamp ✦ 🧬Bioinformatics Terminal Access ✦ 🧬Gene Sequencing & Genomics ✦ 📜Industry Certificate ✦
Course Benefits

Why Choose This Course?

Get more than just education — join a comprehensive learning experience engineered for your success in the genetic engineering and biotechnology industry

Industry-Recognized Certificate
Earn a verified certificate recognised by top biotech and pharma companies including Biocon, Dr. Reddy's Laboratories, Piramal Pharma, and Serum Institute — a credential employers trust.
Real Biotech Tool Labs
Hands-on practice with CRISPR Cas9, BLAST, Galaxy, PyMOL, and industry-standard molecular biology and bioinformatics tools used by top research labs and biotech companies.
Career Assistance
Get targeted career guidance, biotech-specific resume reviews, technical interview prep, and networking sessions with senior scientists and research directors.
Global Community
Join thousands of biotech professionals worldwide and network with scientists, researchers, and biotech leaders from top pharma companies and research institutions.

Trusted by Industry Leaders

Our curriculum is designed in alignment with leading biotech companies and research institutions to ensure you learn the most in-demand genetic engineering skills

Amazon
Google
Microsoft
IBM
Bosch

Reviews from Students

Don't just take our word for it — hear what our students have to say about their Genetic Engineering & Biotechnology learning experience

★★★★★4.9/5 from 2,800+ students
RK
Rohan Nair
Cell Biology Analyst
IISc Bangalore
★★★★★

"The CRISPR gene editing and genomics modules are truly exceptional! The depth of coverage on guide RNA design, off-target analysis, and HDR repair mechanisms is unmatched. The live PCR and NGS lab simulations prepared me perfectly for real research work. I landed my Scientist role at Biocon within 4 weeks of completing this programme."

✓ Verified Purchase2 months ago
AV
Priya Krishnamurthy
Genomics Analyst
Dr. Reddy's Laboratories
★★★★★

"The protein engineering and bioinformatics sections were incredibly detailed. The BLAST analysis, sequence alignment, and structural prediction workflows gave me a massive advantage in interviews. The NGS data analysis module alone is worth the entire course fee."

✓ Verified Purchase3 months ago
SK
Vikram Iyer
Molecular Biology Researcher
Piramal Pharma
★★★★★

"Outstanding coverage of molecular cloning, cell culture, and genetic analysis. The experimental design framework and real-world case studies are exactly what pharma and biotech firms look for. The mentor support throughout the bootcamp was excellent — the instructors have real research lab experience!"

✓ Verified Purchase1 month ago
4.9/5
Average Rating
97%
Success Ratio
100%
Career Support
2.8k+
Success Stories
Course Content

Course Curriculum

A comprehensive learning path from molecular biology fundamentals to advanced genomics, CRISPR gene editing, and industry-ready research workflows

46 Modules 182 Lessons 18 Weeks
  • ▶DNA Structure, Replication & the Central Dogma
  • ▶Transcription & Translation — Gene Expression Fundamentals
  • ▶Cell Organelles & Prokaryotic vs Eukaryotic Cells
  • ▶Chromosomes, Mutations & Genetic Variation
  • ▶Mendelian & Non-Mendelian Inheritance Patterns
  • ▶Overview of Modern Genetic Engineering Techniques
  • ▶Restriction Enzymes — Types, Mechanism & Applications
  • ▶Vectors — Plasmids, Bacteriophages, BACs & YACs
  • ▶Ligation, Transformation & Bacterial Cloning Workflow
  • ▶Blue-White Screening & Colony Selection
  • ▶PCR — Design, Optimisation & Troubleshooting
  • ▶Gel Electrophoresis & Southern/Northern Blotting
  • ▶Restriction Mapping & Cloning Strategy Design
  • ▶Expression Vectors & Inducible Promoters
  • ▶Gateway & Gibson Assembly Cloning Methods
  • ▶Project: Full Cloning Workflow Simulation — GFP into pET-28a
  • ▶CRISPR Mechanism — PAM, Guide RNA & Cas9 Cleavage
  • ▶Guide RNA Design Principles & Off-Target Prediction
  • ▶NHEJ vs HDR Repair Pathways — Knockouts & Knock-ins
  • ▶Delivery Methods — Viral (AAV, Lentivirus) & Non-Viral
  • ▶CRISPR Variants — Cas12a, Base Editing & Prime Editing
  • ▶CRISPRi & CRISPRa for Gene Regulation
  • ▶Off-Target Analysis & Validation Assays (T7E1, Surveyor)
  • ▶Project: Designing a CRISPR Knockout Experiment for BRCA1
  • ▶Genome Organisation — Exons, Introns, Regulatory Regions
  • ▶Sanger Sequencing vs NGS Platforms (Illumina, PacBio, Nanopore)
  • ▶NGS Workflow — Library Prep, Sequencing & Data Output
  • ▶Whole Genome, Exome & Targeted Sequencing Strategies
  • ▶RNA-Seq — Transcriptomics & Differential Gene Expression
  • ▶Variant Calling — SNPs, InDels & Structural Variants
  • ▶Project: NGS Data Analysis Pipeline for a Cancer Genome Dataset
  • ▶NCBI, Ensembl & UCSC Genome Databases
  • ▶BLAST — Sequence Alignment & Homology Searches
  • ▶Multiple Sequence Alignment — ClustalW & MUSCLE
  • ▶Phylogenetic Tree Construction & Evolutionary Analysis
  • ▶Python & R for Bioinformatics — Biopython, DESeq2
  • ▶Galaxy Platform — NGS Analysis Without Coding
  • ▶Project: Complete Bioinformatics Pipeline on Real Genomics Data
  • ▶Protein Structure — Primary to Quaternary & Folding
  • ▶Site-Directed Mutagenesis & Directed Evolution
  • ▶Prokaryotic Expression — E. coli BL21 & Optimisation
  • ▶Eukaryotic Systems — Yeast, Baculovirus & Mammalian Cells
  • ▶Protein Purification — Affinity, Ion Exchange & Size Exclusion
  • ▶SDS-PAGE, Western Blot & ELISA Characterisation
  • ▶Protein Structure Prediction — AlphaFold & PyMOL Visualisation
  • ▶Monoclonal Antibody Production & Engineering
  • ▶Project: Express and Purify a Recombinant Therapeutic Protein
  • ▶Creating Transgenic Plants — Agrobacterium & Biolistics
  • ▶Transgenic Animals — Knockout Mice & Zebrafish Models
  • ▶Gene Therapy Approaches — In Vivo vs Ex Vivo
  • ▶Viral Vectors for Gene Therapy — AAV, Lentivirus, Adenovirus
  • ▶CAR-T Cell Engineering & Immunotherapy
  • ▶RNA Therapeutics — siRNA, miRNA & mRNA Vaccines
  • ▶Project: Designing a Gene Therapy Strategy for a Genetic Disorder
  • ▶Aseptic Technique & Biosafety Levels (BSL-1 to BSL-4)
  • ▶Primary Cell & Established Cell Line Maintenance
  • ▶Transfection Methods — Lipofection, Electroporation & Viral
  • ▶Flow Cytometry & Cell Sorting Techniques
  • ▶Stem Cell Types — ESCs, iPSCs & Adult Stem Cells
  • ▶Differentiation Protocols & Organoid Technology
  • ▶3D Bioprinting & Scaffold-Based Tissue Engineering
  • ▶Project: iPSC Reprogramming & Directed Differentiation Design
  • ▶Biosafety Guidelines — WHO, CDC & IBSC Regulations
  • ▶GMO Regulations — India (GEAC), US (FDA/EPA) & EU
  • ▶Intellectual Property in Biotech — Patents & Licensing
  • ▶Ethical Debates — Human Gene Editing, Designer Babies & Equity
  • ▶Clinical Trial Design & GLP/GMP Standards
  • ▶Project: Regulatory Submission Dossier for a CRISPR Therapy
  • ▶Metabolic Pathway Engineering & Flux Analysis
  • ▶Fermentation Technology — Bioreactor Design & Scale-Up
  • ▶Biofuels, Bioplastics & Industrial Enzymes Production
  • ▶Synthetic Biology — Genetic Circuits & BioBrick Design
  • ▶Project: Design a Metabolic Engineering Strategy for Insulin Production

+ 44 more modules including Immunogenomics, Synthetic Biology, Drug Discovery, Nanotechnology & Capstone CRISPR Research Project

How will your training work?

Follow our structured learning path designed to take you from molecular biology basics to advanced genetic engineering through live lab simulations and expert researcher mentorship.

Step 01
Learn Concepts
Go through training videos covering molecular biology, CRISPR editing, PCR, genomics, and bioinformatics at your own pace with expert researcher instructors.
Step 02
Test Yourself
Test your knowledge through module quizzes, virtual lab simulations, and biotech technical interview-style practice assessments.
Step 03
Live Biotech Labs
Work on real genomic data using CRISPR design tools, BLAST, Galaxy, and PyMOL. Build complete gene editing experiments, NGS pipelines, and protein structures.
Step 04
1:1 Doubt Solving
Get your molecular biology and bioinformatics doubts resolved by senior researchers and PhD scientists through the Q&A portal within 24 hours.
Step 05
Take Final Exam
Complete your capstone research project — a full CRISPR gene editing experiment design with genomics analysis — and pass the final assessment.
Step 06
Get Certified
Earn your professional Genetic Engineering & Biotechnology certification and placement support begins immediately — your biotech career awaits.

Ready to Start Your Biotech Career?

Join thousands of students who have successfully completed our programme and landed roles at top biotech companies, pharma firms, and research institutions.

Self-paced learning Expert support Live CRISPR & lab simulations
Enroll Now — ₹12,999 →
Professional Certifications

Industry-recognized & Government Approved Certificates

Verified certificates recognised by biotech companies and research institutions and government bodies — the proof employers demand when hiring scientists and researchers.

🏛️
Government
Skill India Certificate
Nationally recognised certificate issued under Skill India — Ministry of Skill Development & Entrepreneurship.
NSDC ApprovedGovt. Backed
🎓
Industry
NSDC Certification
National Skill Development Corporation certified course completion, trusted by top biotech companies, pharma firms, and research institutions across India.
Industry-RecognizedPan India
✅
Quality
ISO Certified Program
Our Genetic Engineering & Biotechnology training programme is ISO 9001:2015 certified, ensuring internationally recognised quality standards.
ISO 9001:2015Global Standard
⚖️
Legal
MCA Govt. Approved
Ministry of Corporate Affairs approved certification that adds legal validity to your professional genetic engineering and biotechnology researcher profile.
MCA VerifiedCorporate Valid
Xchieve vs Others

Why Choose Xchieve Over Others?

Compare our comprehensive Genetic Engineering learning experience with other popular platforms. See why thousands choose Xchieve to launch their biotech career.

Features
⭐ Best Value
Xchieve
Coursera
Udemy
edX
Government Certified Courses
NSDC & Skill India certified programs
✓
✕
✕
✕
100% Career Assistance
Full placement & career support
✓
✕
✕
✕
Live CRISPR Gene Editing Labs
Real CRISPR, PCR, NGS & Bioinformatics environments
✓
✕
✕
✕
Live 1:1 Mentorship
Personal mentor from biotech research industry
✓
✕
✓
✕
Lifetime Course Access
Access all course materials forever
✓
✓
✕
✓
24/7 Doubt Support
Round-the-clock biotech & research technical assistance
✓
✕
✓
✕
Resume & Interview Prep
Biotech & research-specific technical interview prep
✓
✓
✕
✓
AI-Powered Learning Path
Personalised curriculum based on career goals
✓
✕
✕
✕
Premium Community Access
Exclusive biotech & research professional network
✓
✓
✕
✕
Overall Score
9/9 ✦
4/9
3/9
3/9
Xchieve
⭐ Best Value
9 / 9 ✦
Government Certified Courses✓
100% Career Assistance✓
Live CRISPR Gene Editing Labs✓
Live 1:1 Mentorship✓
Lifetime Course Access✓
24/7 Doubt Support✓
Resume & Interview Prep✓
AI-Powered Learning Path✓
Premium Community Access✓
Coursera
4 / 9
Government Certified Courses✕
100% Career Assistance✕
Live CRISPR Gene Editing Labs✕
Live 1:1 Mentorship✕
Lifetime Course Access✓
24/7 Doubt Support✕
Resume & Interview Prep✓
AI-Powered Learning Path✕
Premium Community Access✓
Udemy
3 / 9
Government Certified Courses✕
100% Career Assistance✕
Live CRISPR Gene Editing Labs✕
Live 1:1 Mentorship✓
Lifetime Course Access✕
24/7 Doubt Support✓
Resume & Interview Prep✕
AI-Powered Learning Path✕
Premium Community Access✕
edX
3 / 9
Government Certified Courses✕
100% Career Assistance✕
Live CRISPR Gene Editing Labs✕
Live 1:1 Mentorship✕
Lifetime Course Access✓
24/7 Doubt Support✕
Resume & Interview Prep✓
AI-Powered Learning Path✕
Premium Community Access✕
Your Credentials

Certificates You'll Earn After Completing the Genetic Engineering & Biotechnology Program

Earn verified credentials that showcase your genetic engineering and biotechnology expertise to employers worldwide.

1
Course Completion Certificate
Acknowledge your hard work with a certificate from Xchieve upon successfully finishing the Genetic Engineering & Biotechnology programme.
2
Internship Certificate
After completing a hands-on biotech research internship, you will receive an official certificate from Xchieve and top-tier research institutions.
3
Industry Certificate
Earn a prestigious industry certificate from well-known biotech companies and research institutions as recognition of your practical genetic engineering expertise.
4
Government Recognized Certificate
Receive NSDC & Skill India certified credentials backed by the Government of India's Ministry of Skill Development.
🏛️ Govt. Approved
✅ ISO Certified
🎓 NSDC Backed
⚖️ MCA Verified
Flexible Pricing

Pick the Plan That Launches Your Career

One-time payment. Lifetime access. Industry-recognised certificates included in every plan.

● StarterSave 50%
Self Paced Program
Study at your own speed
₹5,999
/course  ·  ₹11,999
What's included
  • ✓Genetic Engineering Video Lectures
  • ✓Industry-Based Case Studies
  • ✓Industry Graded Certificates
  • ✓Doubt Clearing Sessions
  • ✓Quiz & Assessments
  • ✓Personal Dashboard
  • —Placement Assistance
  • —AI Mock Interview Portal
  • —1-on-1 Career Counselling
Get Started →
⭐ Most PopularSave 50%
Mentor-led Program
Live guidance from research experts
₹8,999
/course  ·  ₹17,999
🎉 Early bird price applied!
What's included
  • ✓Genetic Engineering Video Lectures
  • ✓Industry-Based Case Studies
  • ✓Industry Graded Certificates
  • ✓Doubt Clearing Sessions
  • ✓Quiz & Assessments
  • ✓Personal Dashboard
  • ✓Resume Building
  • ✓AI Mock Interview Portal
  • —Placement Assistance
  • —1-on-1 Career Counselling
Start Learning →
● Premium🏆 Best Value
SAVE 50%
Career Edge
Everything you need to get hired
₹12,999
/course  ·  ₹25,999
🎉 Extra early bird discount!
Everything included
  • ✓Genetic Engineering Video Lectures
  • ✓Industry-Based Case Studies
  • ✓Industry Graded Certificates
  • ✓Doubt Clearing Sessions
  • ✓Quiz & Assessments
  • ✓Personal Dashboard
  • ✓Resume Building
  • ✓Personality Development
  • ✓Optimize Your LinkedIn
  • ✓AI Mock Interview Portal
  • ✓Placement Assistance
  • ✓1-on-1 Career Counselling
  • ✓Internship Guarantee Letter
  • ✓Priority Job Referrals
Start Learning →
🔒 Secure Payment ⚡ Instant Access ♾ Lifetime Updates 💬 24/7 Support
Got Questions?

Frequently Asked Questions

Everything you need to know before you enrol in our Genetic Engineering & Biotechnology course. Can't find your answer? Reach out to us anytime.

Do I need prior biology or lab knowledge before joining?+
Basic biology knowledge is helpful but not mandatory. Our course starts from molecular biology fundamentals and builds progressively up to advanced CRISPR editing, genomics, and bioinformatics. Students from engineering, chemistry, and non-biology backgrounds have successfully completed this programme.
Will I get access to real biotech lab simulations and bioinformatics tools?+
Yes! All enrolled students get guided access to CRISPR design platforms, bioinformatics pipelines (BLAST, Galaxy, UCSC), and simulated NGS analysis environments. Career Edge plan students also receive live virtual lab session credits and additional genomics database access for the duration of the programme.
Is there a pre-registration option available?+
Yes, you can pre-register to lock in the early bird pricing before the next cohort begins. Pre-registered students are first to receive access and get exclusive onboarding resources including a biotech technical interview question bank, lab techniques cheat sheet, and a genomics reference guide.
What is the refund policy?+
Our courses are crafted with care and commitment, and as such, we do not offer refunds. We believe in the value and quality of our educational services and encourage you to attend a free demo session before enrolling.
What roles can I target after completing this Genetics course?+
Graduates from our programme have landed roles as Research Scientist, Genetic Engineer, Bioinformatics Analyst, Lab Scientist, R&D Associate, and Clinical Research Associate at firms including Biocon, Dr. Reddy's Laboratories, Cipla, Piramal Pharma, Serum Institute, Reliance Life Sciences, Syngene International, CSIR-IGIB, and IISc Bangalore.
What are the timings of the live sessions?+
Live mentor sessions and bootcamp classes are scheduled after 6 PM on weekdays to suit working professionals and college students. Recordings are available within 24 hours for those who miss a session, including all live lab simulation walkthroughs.
Support Available 24/7
Still have questions?
Our expert research team is here to help — reach out anytime via chat, WhatsApp, or a free counselling call with a senior scientist or researcher.
Free counselling call with biotech expert
16,000+ community members
No obligation to enroll
Average response time
Under 2 hours
Active community
16,000+ members
Contact Support Join WhatsApp Community
Xchieve Footer